Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein Gelsolin [55759] (2 species) consists of six similar domains |
Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries) Uniprot Q28372 1-346 |
Domain d1d0nb1: 1d0n B:27-152 [40840] |
PDB Entry: 1d0n (more details), 2.5 Å
SCOPe Domain Sequences for d1d0nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d0nb1 d.109.1.1 (B:27-152) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} vehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydlh ywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggva sgfkhv
Timeline for d1d0nb1: