Lineage for d3gbnh_ (3gbn H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755730Domain d3gbnh_: 3gbn H: [408362]
    Other proteins in same PDB: d3gbna1, d3gbna2, d3gbnb_
    automated match to d6shgh_
    complexed with cl, edo, etx, gol, nag, unl

Details for d3gbnh_

PDB Entry: 3gbn (more details), 2.2 Å

PDB Description: crystal structure of fab cr6261 in complex with the 1918 h1n1 influenza virus hemagglutinin
PDB Compounds: (H:) Fab heavy chain

SCOPe Domain Sequences for d3gbnh_:

Sequence, based on SEQRES records: (download)

>d3gbnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasggpfrsyaiswvrqapgqgpewmggiipifgttky
apkfqgrvtitaddfagtvymelsslrsedtamyycakhmgyqvretmdvwgkgttvtvs
sastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqs
sglysls

Sequence, based on observed residues (ATOM records): (download)

>d3gbnh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgaevkkpgssvkvsckasggpfrsyaiswvrqapgqgpewmggiipifgttky
apkfqgrvtitaddfagtvymelsslrsedtamyycakhmgyqvretmdvwgkgttvtvs
sastkgpsvfplgclvkdyfpepvttfpavlqssglysls

SCOPe Domain Coordinates for d3gbnh_:

Click to download the PDB-style file with coordinates for d3gbnh_.
(The format of our PDB-style files is described here.)

Timeline for d3gbnh_:

  • d3gbnh_ is new in SCOPe 2.08-stable