Lineage for d1d0na3 (1d0n A:263-383)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83135Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 83136Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 83137Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 83138Protein Gelsolin [55759] (2 species)
  7. 83139Species Horse (Equus caballus) [TaxId:9796] [55760] (1 PDB entry)
  8. 83142Domain d1d0na3: 1d0n A:263-383 [40836]

Details for d1d0na3

PDB Entry: 1d0n (more details), 2.5 Å

PDB Description: the crystal structure of calcium-free equine plasma gelsolin.

SCOP Domain Sequences for d1d0na3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus)}
edaanrklaklykvsngagpmvvslvadenpfaqgalrsedcfildhgkdgkifvwkgkq
anmeerkaalktasdfiskmdypkqtqvsvlpeggetplfrqffknwrdpdqteglglay
l

SCOP Domain Coordinates for d1d0na3:

Click to download the PDB-style file with coordinates for d1d0na3.
(The format of our PDB-style files is described here.)

Timeline for d1d0na3: