Lineage for d1svy__ (1svy -)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509537Fold d.109: Gelsolin-like [55752] (2 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509538Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 509539Family d.109.1.1: Gelsolin-like [55754] (4 proteins)
  6. 509597Protein Severin, domain 2 [55757] (1 species)
  7. 509598Species Dictyostelium discoideum [TaxId:44689] [55758] (3 PDB entries)
  8. 509599Domain d1svy__: 1svy - [40831]

Details for d1svy__

PDB Entry: 1svy (more details), 1.75 Å

PDB Description: severin domain 2, 1.75 angstrom crystal structure

SCOP Domain Sequences for d1svy__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svy__ d.109.1.1 (-) Severin, domain 2 {Dictyostelium discoideum}
eykprllhisgdknakvaevplatsslnsgdcflldagltiyqfngsksspqeknkaaev
araidaerkglpkvevfcetdsdipaefwkllggkgaiaakh

SCOP Domain Coordinates for d1svy__:

Click to download the PDB-style file with coordinates for d1svy__.
(The format of our PDB-style files is described here.)

Timeline for d1svy__: