Lineage for d3c6sf_ (3c6s F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744311Domain d3c6sf_: 3c6s F: [408304]
    Other proteins in same PDB: d3c6sa1, d3c6sa2, d3c6sc1, d3c6sc2, d3c6se1, d3c6se2, d3c6sg1, d3c6sg2
    automated match to d6shgh_
    complexed with pd

Details for d3c6sf_

PDB Entry: 3c6s (more details), 1.8 Å

PDB Description: crystal structure of fab f22-4 in complex with a shigella flexneri 2a o-ag pentadecasaccharide
PDB Compounds: (F:) Fab F22-4 heavy chain

SCOPe Domain Sequences for d3c6sf_:

Sequence, based on SEQRES records: (download)

>d3c6sf_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkveesggglvqpggsmkiscvvsgltfsnywmswvrqspekglewvaeirlksdnyat
yyaesvkgkftisrddsksrlylqmnnlrtedtgiyycflpmdywgqgtsvtvssakttp
psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d3c6sf_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkveesggglvqpggsmkiscvvsgltfsnywmswvrqspekglewvaeirlksdnyat
yyaesvkgkftisrddsksrlylqmnnlrtedtgiyycflpmdywgqgtsvtvssakttp
psvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d3c6sf_:

Click to download the PDB-style file with coordinates for d3c6sf_.
(The format of our PDB-style files is described here.)

Timeline for d3c6sf_:

  • d3c6sf_ is new in SCOPe 2.08-stable