Lineage for d3c5sd_ (3c5s D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744320Domain d3c5sd_: 3c5s D: [408301]
    Other proteins in same PDB: d3c5sa1, d3c5sa2, d3c5sc1, d3c5sc2
    automated match to d6shgh_

Details for d3c5sd_

PDB Entry: 3c5s (more details), 2 Å

PDB Description: Crystal Structure of monoclonal Fab F22-4 specific for Shigella flexneri 2a O-Ag
PDB Compounds: (D:) Fab F22-4 heavy chain

SCOPe Domain Sequences for d3c5sd_:

Sequence, based on SEQRES records: (download)

>d3c5sd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkveesggglvqpggsmkiscvvsgltfsnywmswvrqspekglewvaeirlksdnyat
yyaesvkgkftisrddsksrlylqmnnlrtedtgiyycflpmdywgqgtsvtvssakttp
psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d3c5sd_ b.1.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evkveesggglvqpggsmkiscvvsgltfsnywmswvrqspekglewvaeirlksdnyat
yyaesvkgkftisrddsksrlylqmnnlrtedtgiyycflpmdywgqgtsvtvssakttp
psvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvps
stwpsetvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d3c5sd_:

Click to download the PDB-style file with coordinates for d3c5sd_.
(The format of our PDB-style files is described here.)

Timeline for d3c5sd_:

  • d3c5sd_ is new in SCOPe 2.08-stable