Lineage for d2vik__ (2vik -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) 
Family d.109.1.1: Gelsolin-like [55754] (3 proteins) 
Protein Villin, domain 1 (res. 1-126) [55755] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [55756] (2 PDB entries) 
Domain d2vik__: 2vik - [40829]
Details for d2vik__
PDB Entry: 2vik (more details)
PDB Description: refined structure of the actin-severing domain villin 14t, determined by solution nmr, minimized average structure
SCOP Domain Sequences for d2vik__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vik__ d.109.1.1 (-) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus)}
velskkvtgkldkttpgiqiwrienmemvpvptksygnfyegdcyvllstrktgsgfsyn
ihywlgknssqdeqgaaaiyttqmdeylgsvavqhrevqghesetfrayfkqgliykqgg
vasgmk
SCOP Domain Coordinates for d2vik__:
Click to download the PDB-style file with coordinates for d2vik__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vik__:
- d2vik__ first appeared (with stable ids) in SCOP 1.55
- d2vik__ appears in SCOP 1.59
- d2vik__ appears in the current release, SCOPe 2.08, called d2vika_
View in 3D