Lineage for d2vik__ (2vik -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35145Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily)
  4. 35146Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) (S)
  5. 35147Family d.109.1.1: Gelsolin-like [55754] (3 proteins)
  6. 35179Protein Villin, domain 1 (res. 1-126) [55755] (1 species)
  7. 35180Species Chicken (Gallus gallus) [TaxId:9031] [55756] (2 PDB entries)
  8. 35181Domain d2vik__: 2vik - [40829]

Details for d2vik__

PDB Entry: 2vik (more details)

PDB Description: refined structure of the actin-severing domain villin 14t, determined by solution nmr, minimized average structure

SCOP Domain Sequences for d2vik__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vik__ d.109.1.1 (-) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus)}
velskkvtgkldkttpgiqiwrienmemvpvptksygnfyegdcyvllstrktgsgfsyn
ihywlgknssqdeqgaaaiyttqmdeylgsvavqhrevqghesetfrayfkqgliykqgg
vasgmk

SCOP Domain Coordinates for d2vik__:

Click to download the PDB-style file with coordinates for d2vik__.
(The format of our PDB-style files is described here.)

Timeline for d2vik__: