| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) ![]() |
| Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein) duplication: consists of two NAT-like domains swapped with the C-terminal strands |
| Protein N-myristoyl transferase, NMT [55749] (3 species) |
| Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries) |
| Domain d1nmtc2: 1nmt C:225-451 [40828] complexed with gol |
PDB Entry: 1nmt (more details), 2.45 Å
SCOP Domain Sequences for d1nmtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmtc2 d.108.1.2 (C:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll
Timeline for d1nmtc2:
View in 3DDomains from other chains: (mouse over for more information) d1nmta1, d1nmta2, d1nmtb1, d1nmtb2 |