Lineage for d2yjtd_ (2yjt D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871929Species Escherichia coli [TaxId:83333] [334882] (9 PDB entries)
  8. 2871941Domain d2yjtd_: 2yjt D: [408267]
    Other proteins in same PDB: d2yjta_, d2yjtb_, d2yjtc_
    automated match to d6s8ra_
    protein/RNA complex

Details for d2yjtd_

PDB Entry: 2yjt (more details), 2.9 Å

PDB Description: crystal structure of e. coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
PDB Compounds: (D:) ATP-dependent RNA helicase srmb

SCOPe Domain Sequences for d2yjtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjtd_ c.37.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
rkkihqwyyraddlehktallvhllkqpeatrsivfvrkrervhelanwlreaginncyl
egemvqgkrneaikrltegrvnvlvatdvaargidipdvshvfnfdmprsgdtylhrigr
taragrkgtaislveahdhlllgkvgryieepikarvidelrpktrapse

SCOPe Domain Coordinates for d2yjtd_:

Click to download the PDB-style file with coordinates for d2yjtd_.
(The format of our PDB-style files is described here.)

Timeline for d2yjtd_:

  • d2yjtd_ is new in SCOPe 2.08-stable