Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (158 species) not a true protein |
Species Escherichia coli [TaxId:83333] [334882] (9 PDB entries) |
Domain d2yjtd_: 2yjt D: [408267] Other proteins in same PDB: d2yjta_, d2yjtb_, d2yjtc_ automated match to d6s8ra_ protein/RNA complex |
PDB Entry: 2yjt (more details), 2.9 Å
SCOPe Domain Sequences for d2yjtd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yjtd_ c.37.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]} rkkihqwyyraddlehktallvhllkqpeatrsivfvrkrervhelanwlreaginncyl egemvqgkrneaikrltegrvnvlvatdvaargidipdvshvfnfdmprsgdtylhrigr taragrkgtaislveahdhlllgkvgryieepikarvidelrpktrapse
Timeline for d2yjtd_: