SCOP 1.73: Domain d1nmtb2: 1nmt B:225-451

Lineage for d1nmtb2 (1nmt B:225-451)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (3 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)

8. Domain d1nmtb2: 1nmt B:225-451 [40826]

Details for d1nmtb2

PDB Entry: 1nmt, 2.45 Å

PDB Description: n-myristoyl transferase from candida albicans at 2.45 a

PDB Compounds: (B:) n-myristoyl transferase

SCOP Domain Sequences for d1nmtb2:

Sequence; same for both SEQRES and ATOM records:

>d1nmtb2 d.108.1.2 (B:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

Timeline for d1nmtb2:

• d1nmtb2 first appeared (with stable ids) in SCOP 1.55
  
• d1nmtb2 appears in SCOP 1.71
  
• d1nmtb2 appears in SCOP 1.75
  
• d1nmtb2 appears in the current release, SCOPe 2.08