Lineage for d2xqbh_ (2xqb H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758665Domain d2xqbh_: 2xqb H: [408255]
    Other proteins in same PDB: d2xqba_, d2xqbl2
    automated match to d6shgh_
    complexed with so4

Details for d2xqbh_

PDB Entry: 2xqb (more details), 2.6 Å

PDB Description: crystal structure of anti-il-15 antibody in complex with human il-15
PDB Compounds: (H:) anti-il-15 antibody

SCOPe Domain Sequences for d2xqbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xqbh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgasvkvsckasgysfssfgiswvrqapgqglewlgwisafngytky
aqkfqdrvtmttdtststaymelrslrsddtavyycardpaawplqqslawfdpwgqgtm
vtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpa
vlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepks

SCOPe Domain Coordinates for d2xqbh_:

Click to download the PDB-style file with coordinates for d2xqbh_.
(The format of our PDB-style files is described here.)

Timeline for d2xqbh_:

  • d2xqbh_ is new in SCOPe 2.08-stable