Lineage for d2vxqh_ (2vxq H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755563Domain d2vxqh_: 2vxq H: [408228]
    Other proteins in same PDB: d2vxqa_, d2vxql2
    automated match to d6shgh_

Details for d2vxqh_

PDB Entry: 2vxq (more details), 1.9 Å

PDB Description: crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
PDB Compounds: (H:) fab

SCOPe Domain Sequences for d2vxqh_:

Sequence, based on SEQRES records: (download)

>d2vxqh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesgpglvkpaqtlslscavsggsirsggyywswirqhpgkglewigyiyhsgntyy
npslksriamsvdtsenkfslrlnsvtaadtavyycarldgytldiwgqgtlvtvssstk
gpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d2vxqh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqllesgpglvkpaqtlslscavsggsirsggyywswirqhpgkglewigyiyhsgntyy
npslksriamsvdtsenkfslrlnsvtaadtavyycarldgytldiwgqgtlvtvssstk
gpsvfplapsssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d2vxqh_:

Click to download the PDB-style file with coordinates for d2vxqh_.
(The format of our PDB-style files is described here.)

Timeline for d2vxqh_:

  • d2vxqh_ is new in SCOPe 2.08-stable