Lineage for d2vejb1 (2vej B:4-182)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971674Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2971675Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2971694Domain d2vejb1: 2vej B:4-182 [408210]
    Other proteins in same PDB: d2vejb2
    automated match to d1nfsa_
    complexed with mn

Details for d2vejb1

PDB Entry: 2vej (more details), 2.2 Å

PDB Description: monoclinic form of idi-1
PDB Compounds: (B:) Isopentenyl-diphosphate delta-isomerase

SCOPe Domain Sequences for d2vejb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vejb1 d.113.1.2 (B:4-182) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvcghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaftqlk

SCOPe Domain Coordinates for d2vejb1:

Click to download the PDB-style file with coordinates for d2vejb1.
(The format of our PDB-style files is described here.)

Timeline for d2vejb1:

  • d2vejb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2vejb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2veja_