Lineage for d1b6bb_ (1b6b B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35089Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 35090Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 35091Family d.108.1.1: N-acetyl transferase, NAT [55730] (8 proteins)
  6. 35128Protein Serotonin N-acetyltranferase [55746] (1 species)
  7. 35129Species Sheep (Ovis aries) [TaxId:9940] [55747] (2 PDB entries)
  8. 35132Domain d1b6bb_: 1b6b B: [40820]

Details for d1b6bb_

PDB Entry: 1b6b (more details), 2.5 Å

PDB Description: melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism

SCOP Domain Sequences for d1b6bb_:

Sequence, based on SEQRES records: (download)

>d1b6bb_ d.108.1.1 (B:) Serotonin N-acetyltranferase {Sheep (Ovis aries)}
nefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvafi
igslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpavr
ravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal

Sequence, based on observed residues (ATOM records): (download)

>d1b6bb_ d.108.1.1 (B:) Serotonin N-acetyltranferase {Sheep (Ovis aries)}
nefrcltpedaagvfeiereafdevqhfltlcpelslgwfvegrlvafiigslwdeerlt
qeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalv
pfyqrfgfhpagpcaivvgsltftemhcslrghaal

SCOP Domain Coordinates for d1b6bb_:

Click to download the PDB-style file with coordinates for d1b6bb_.
(The format of our PDB-style files is described here.)

Timeline for d1b6bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b6ba_