SCOPe 2.07: Domain d1b6ba_: 1b6b A:

Lineage for d1b6ba_ (1b6b A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Serotonin N-acetyltranferase [55746] (1 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)

8. Domain d1b6ba_: 1b6b A: [40819]

Details for d1b6ba_

PDB Entry: 1b6b, 2.5 Å

PDB Description: melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism

PDB Compounds: (A:) protein (arylalkylamine n-acetyltransferase)

SCOPe Domain Sequences for d1b6ba_:

Sequence; same for both SEQRES and ATOM records:

>d1b6ba_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}
anefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvaf
iigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpav
rravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal

Timeline for d1b6ba_:

• d1b6ba_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6ba_ appears in SCOPe 2.06
  
• d1b6ba_ appears in the current release, SCOPe 2.08