![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins) |
![]() | Protein Serotonin N-acetyltranferase [55746] (1 species) |
![]() | Species Sheep (Ovis aries) [TaxId:9940] [55747] (3 PDB entries) |
![]() | Domain d1b6ba_: 1b6b A: [40819] |
PDB Entry: 1b6b (more details), 2.5 Å
SCOP Domain Sequences for d1b6ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6ba_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries)} anefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvaf iigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpav rravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
Timeline for d1b6ba_: