SCOP 1.67: Domain d1cjwa_: 1cjw A:

Lineage for d1cjwa_ (1cjw A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (18 proteins)

6. Protein Serotonin N-acetyltranferase [55746] (1 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [55747] (7 PDB entries)

8. Domain d1cjwa_: 1cjw A: [40818]
   complexed with cot

Details for d1cjwa_

PDB Entry: 1cjw, 1.8 Å

PDB Description: serotonin n-acetyltransferase complexed with a bisubstrate analog

SCOP Domain Sequences for d1cjwa_:

Sequence; same for both SEQRES and ATOM records:

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries)}
htlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegr
lvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvga
qpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcsl

Timeline for d1cjwa_:

• d1cjwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjwa_ appears in SCOP 1.65
  
• d1cjwa_ appears in SCOP 1.69
  
• d1cjwa_ appears in the current release, SCOPe 2.08