Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries) |
Domain d2qqkh1: 2qqk H:1-213 [408176] Other proteins in same PDB: d2qqkl1, d2qqkl2 automated match to d6shgh_ complexed with nag |
PDB Entry: 2qqk (more details), 2.75 Å
SCOPe Domain Sequences for d2qqkh1:
Sequence, based on SEQRES records: (download)
>d2qqkh1 b.1.1.1 (H:1-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftisgygihwvrqapgkglewvayiypdsgytdy adsvkgrftisadtskntaylqmnslraedtavyycaredfrnrrrlwyvmdywgqgtlv tvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpav lqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
>d2qqkh1 b.1.1.1 (H:1-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqlvesggglvqpggslrlscaasgftisgygihwvrqapgkglewvayiypdsgytdy adsvkgrftisadtskntaylqmnslraedtavyycaredfrnrrrlwyvmdywgqgtlv tvssastkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly slssvvtvpssslgtqtyicnvnhkpsntkvdkkvep
Timeline for d2qqkh1: