Lineage for d1qsmc_ (1qsm C:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 416835Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 416836Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 416837Family d.108.1.1: N-acetyl transferase, NAT [55730] (18 proteins)
  6. 416901Protein Histone acetyltransferase HPA2 [55740] (1 species)
  7. 416902Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries)
  8. 416909Domain d1qsmc_: 1qsm C: [40810]

Details for d1qsmc_

PDB Entry: 1qsm (more details), 2.4 Å

PDB Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae in Complex with Acetyl Coenzyme A

SCOP Domain Sequences for d1qsmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsmc_ d.108.1.1 (C:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae)}
nitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavessse
kiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvywc
tdesnhraqllyvkvgykapkilykrkgy

SCOP Domain Coordinates for d1qsmc_:

Click to download the PDB-style file with coordinates for d1qsmc_.
(The format of our PDB-style files is described here.)

Timeline for d1qsmc_: