![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d2h2pe_: 2h2p E: [408093] Other proteins in same PDB: d2h2pa_, d2h2pb_, d2h2pd1, d2h2pd2, d2h2pf1, d2h2pf2 automated match to d6shgh_ complexed with sek |
PDB Entry: 2h2p (more details), 3.1 Å
SCOPe Domain Sequences for d2h2pe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h2pe_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
Timeline for d2h2pe_: