Lineage for d2h2pc_ (2h2p C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745370Domain d2h2pc_: 2h2p C: [408092]
    Other proteins in same PDB: d2h2pa_, d2h2pb_, d2h2pd1, d2h2pd2, d2h2pf1, d2h2pf2
    automated match to d6shgh_
    complexed with sek

Details for d2h2pc_

PDB Entry: 2h2p (more details), 3.1 Å

PDB Description: crystal structure of clc-ec1 in complex with fab fragment in secn-
PDB Compounds: (C:) Fab fragment, heavy chain

SCOPe Domain Sequences for d2h2pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h2pc_ b.1.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra

SCOPe Domain Coordinates for d2h2pc_:

Click to download the PDB-style file with coordinates for d2h2pc_.
(The format of our PDB-style files is described here.)

Timeline for d2h2pc_:

  • d2h2pc_ is new in SCOPe 2.08-stable