Lineage for d2gcyb1 (2gcy B:6-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (616 PDB entries)
  8. 2744617Domain d2gcyb1: 2gcy B:6-218 [408082]
    Other proteins in same PDB: d2gcya1, d2gcya2, d2gcyb2
    automated match to d6shgh_
    complexed with so4

Details for d2gcyb1

PDB Entry: 2gcy (more details), 2.5 Å

PDB Description: humanized antibody C25 Fab fragment
PDB Compounds: (B:) huC25 fab fragment heavy chain

SCOPe Domain Sequences for d2gcyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcyb1 b.1.1.1 (B:6-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esggglvqpggslrlscaasgftfsdyymywvrqapgkglewvatisdggsytyypdsvk
grftisrdnskntlylqmnslraedtamyycsryryddamdywgqgtlvtvssastkgps
vfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d2gcyb1:

Click to download the PDB-style file with coordinates for d2gcyb1.
(The format of our PDB-style files is described here.)

Timeline for d2gcyb1:

  • d2gcyb1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d2gcyb2