Lineage for d1qsma_ (1qsm A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333011Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 333012Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families) (S)
  5. 333013Family d.108.1.1: N-acetyl transferase, NAT [55730] (14 proteins)
  6. 333075Protein Histone acetyltransferase HPA2 [55740] (1 species)
  7. 333076Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55741] (2 PDB entries)
  8. 333077Domain d1qsma_: 1qsm A: [40808]

Details for d1qsma_

PDB Entry: 1qsm (more details), 2.4 Å

PDB Description: Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae in Complex with Acetyl Coenzyme A

SCOP Domain Sequences for d1qsma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae)}
dnitvrfvtendkegwqrlwksyqdfyevsfpddlddfnfgrfldpnikmwaavavesss
ekiigminffnhmttwdfkdkiyindlyvdensrvkgaggkliqfvydeadklgtpsvyw
ctdesnhraqllyvkvgykapkilykrkgy

SCOP Domain Coordinates for d1qsma_:

Click to download the PDB-style file with coordinates for d1qsma_.
(The format of our PDB-style files is described here.)

Timeline for d1qsma_: