Lineage for d5gcna_ (5gcn A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 509342Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 509343Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (5 families) (S)
  5. 509344Family d.108.1.1: N-acetyl transferase, NAT [55730] (20 proteins)
  6. 509373Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)
  7. 509377Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
  8. 509387Domain d5gcna_: 5gcn A: [40807]

Details for d5gcna_

PDB Entry: 5gcn (more details)

PDB Description: catalytic domain of tetrahymena gcn5 histone acetyltransferase in complex with coenzyme a

SCOP Domain Sequences for d5gcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gcna_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila}
mkglldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkq
kviggicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnf
aigyfkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygn

SCOP Domain Coordinates for d5gcna_:

Click to download the PDB-style file with coordinates for d5gcna_.
(The format of our PDB-style files is described here.)

Timeline for d5gcna_: