Lineage for d1qsra_ (1qsr A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136622Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)
  7. 136626Species Tetrahymena thermophila [TaxId:5911] [55739] (4 PDB entries)
  8. 136628Domain d1qsra_: 1qsr A: [40805]

Details for d1qsra_

PDB Entry: 1qsr (more details), 2 Å

PDB Description: crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a

SCOP Domain Sequences for d1qsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdygr

SCOP Domain Coordinates for d1qsra_:

Click to download the PDB-style file with coordinates for d1qsra_.
(The format of our PDB-style files is described here.)

Timeline for d1qsra_: