Lineage for d1qsra1 (1qsr A:49-209)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968418Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (3 species)
  7. 2968424Species Tetrahymena thermophila [TaxId:5911] [55739] (9 PDB entries)
    Uniprot Q27198 49-209
  8. 2968426Domain d1qsra1: 1qsr A:49-209 [40805]
    Other proteins in same PDB: d1qsra2
    complexed with aco

Details for d1qsra1

PDB Entry: 1qsr (more details), 2 Å

PDB Description: crystal structure of tetrahymena gcn5 with bound acetyl-coenzyme a
PDB Compounds: (A:) tgcn5 histone acetyl transferase

SCOPe Domain Sequences for d1qsra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsra1 d.108.1.1 (A:49-209) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}
ldfdiltndgthrnmkllidlknifsrqlpkmpkeyivklvfdrhhesmvilknkqkvig
gicfrqykpqrfaevaflavtaneqvrgygtrlmnkfkdhmqkqnieylltyadnfaigy
fkkqgftkehrmpqekwkgyikdydggtlmecyihpyvdyg

SCOPe Domain Coordinates for d1qsra1:

Click to download the PDB-style file with coordinates for d1qsra1.
(The format of our PDB-style files is described here.)

Timeline for d1qsra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qsra2