SCOP 1.61: Domain d1yghb_: 1ygh B:

Lineage for d1yghb_ (1ygh B:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (3 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (10 proteins)

6. Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55738] (1 PDB entry)

8. Domain d1yghb_: 1ygh B: [40803]

Details for d1yghb_

PDB Entry: 1ygh, 1.9 Å

PDB Description: hat domain of gcn5 from saccharomyces cerevisiae

SCOP Domain Sequences for d1yghb_:

Sequence; same for both SEQRES and ATOM records:

>d1yghb_ d.108.1.1 (B:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae)}
kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld

Timeline for d1yghb_:

• d1yghb_ first appeared (with stable ids) in SCOP 1.55
  
• d1yghb_ appears in SCOP 1.59
  
• d1yghb_ appears in SCOP 1.63
  
• d1yghb_ appears in the current release, SCOPe 2.08