Lineage for d2boca1 (2boc A:6-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745318Domain d2boca1: 2boc A:6-219 [408025]
    Other proteins in same PDB: d2boca2, d2bocb1, d2bocb2, d2bocc_
    automated match to d6shgh_
    complexed with co, t1a, tl

Details for d2boca1

PDB Entry: 2boc (more details), 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)
PDB Compounds: (A:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d2boca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2boca1 b.1.1.1 (A:6-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssakttpps
vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpssswpsetvtcnvahpasstkvdkkivprd

SCOPe Domain Coordinates for d2boca1:

Click to download the PDB-style file with coordinates for d2boca1.
(The format of our PDB-style files is described here.)

Timeline for d2boca1:

  • d2boca1 is new in SCOPe 2.08-stable