SCOPe 2.08: Domain d2boca1: 2boc A:6-219

Lineage for d2boca1 (2boc A:6-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2boca1: 2boc A:6-219 [408025]
   Other proteins in same PDB: d2boca2, d2bocb1, d2bocb2, d2bocc_
   automated match to d6shgh_
   complexed with co, t1a, tl

Details for d2boca1

PDB Entry: 2boc, 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)

PDB Compounds: (A:) antibody fab fragment heavy chain

SCOPe Domain Sequences for d2boca1:

Sequence; same for both SEQRES and ATOM records:

>d2boca1 b.1.1.1 (A:6-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygranynekiq
kkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssakttpps
vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d2boca1:

• d2boca1 is new in SCOPe 2.08-stable