Lineage for d1ygha_ (1ygh A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35089Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 35090Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 35091Family d.108.1.1: N-acetyl transferase, NAT [55730] (8 proteins)
  6. 35099Protein Catalytic domain of GCN5 histone acetyltransferase [55737] (2 species)
  7. 35100Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55738] (1 PDB entry)
  8. 35101Domain d1ygha_: 1ygh A: [40802]

Details for d1ygha_

PDB Entry: 1ygh (more details), 1.9 Å

PDB Description: hat domain of gcn5 from saccharomyces cerevisiae

SCOP Domain Sequences for d1ygha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae)}
kiefrvvnndntkenmmvltglknifqkqlpkmpkeyiarlvydrshlsmavirkpltvv
ggityrpfdkrefaeivfcaissteqvrgygahlmnhlkdyvrntsnikyfltyadnyai
gyfkkqgftkeitldksiwmgyikdyeggtlmqcsmlpriryld

SCOP Domain Coordinates for d1ygha_:

Click to download the PDB-style file with coordinates for d1ygha_.
(The format of our PDB-style files is described here.)

Timeline for d1ygha_: