Lineage for d2ajzb_ (2ajz B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744891Domain d2ajzb_: 2ajz B: [408010]
    Other proteins in same PDB: d2ajza1, d2ajza2, d2ajzl1, d2ajzl2
    automated match to d6shgh_
    complexed with ecg

Details for d2ajzb_

PDB Entry: 2ajz (more details), 2.3 Å

PDB Description: crystal structure of cocaine catalytic antibody 7a1 fab' in complex with ecgonine methyl ester
PDB Compounds: (B:) Antibody 7A1 Fab'

SCOPe Domain Sequences for d2ajzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ajzb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklsesgpglvkpsqslsltctvtgysittnyawtwirqfpgnklewmgyirssvitry
npslksrisitqdtsknqfflqlnsvttedtatyycarydyygntgdywgqgtsvtvssa
kttppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytltssvtvpsstwpsqtvtcnvahpasstkvdkkivpr

SCOPe Domain Coordinates for d2ajzb_:

Click to download the PDB-style file with coordinates for d2ajzb_.
(The format of our PDB-style files is described here.)

Timeline for d2ajzb_:

  • d2ajzb_ is new in SCOPe 2.08-stable