Lineage for d1cm0b_ (1cm0 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136647Protein Histone acetyltransferase domain of P300/CBP associating factor, PCAF [55735] (1 species)
  7. 136648Species Human (Homo sapiens) [TaxId:9606] [55736] (1 PDB entry)
  8. 136650Domain d1cm0b_: 1cm0 B: [40801]

Details for d1cm0b_

PDB Entry: 1cm0 (more details), 2.3 Å

PDB Description: crystal structure of the pcaf/coenzyme-a complex

SCOP Domain Sequences for d1cm0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cm0b_ d.108.1.1 (B:) Histone acetyltransferase domain of P300/CBP associating factor, PCAF {Human (Homo sapiens)}
kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpr

SCOP Domain Coordinates for d1cm0b_:

Click to download the PDB-style file with coordinates for d1cm0b_.
(The format of our PDB-style files is described here.)

Timeline for d1cm0b_: