Lineage for d1cm0a_ (1cm0 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1426963Protein Histone acetyltransferase domain of P300/CBP associating factor, PCAF [55735] (1 species)
  7. 1426964Species Human (Homo sapiens) [TaxId:9606] [55736] (1 PDB entry)
  8. 1426965Domain d1cm0a_: 1cm0 A: [40800]
    complexed with coa

Details for d1cm0a_

PDB Entry: 1cm0 (more details), 2.3 Å

PDB Description: crystal structure of the pcaf/coenzyme-a complex
PDB Compounds: (A:) p300/cbp associating factor

SCOPe Domain Sequences for d1cm0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cm0a_ d.108.1.1 (A:) Histone acetyltransferase domain of P300/CBP associating factor, PCAF {Human (Homo sapiens) [TaxId: 9606]}
kviefhvvgnslnqkpnkkilmwlvglqnvfshqlprmpkeyitrlvfdpkhktlalikd
grviggicfrmfpsqgfteivfcavtsneqvkgygthlmnhlkeyhikhdilnfltyade
yaigyfkkqgfskeikipktkyvgyikdyegatlmgcelnpri

SCOPe Domain Coordinates for d1cm0a_:

Click to download the PDB-style file with coordinates for d1cm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1cm0a_: