Lineage for d1bo4a_ (1bo4 A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136615Protein Aminoglycoside 3-N-acetyltransferase [55733] (1 species)
  7. 136616Species Serratia marcescens [TaxId:615] [55734] (1 PDB entry)
  8. 136617Domain d1bo4a_: 1bo4 A: [40798]

Details for d1bo4a_

PDB Entry: 1bo4 (more details), 2.3 Å

PDB Description: crystal structure of a gcn5-related n-acetyltransferase: serratia marescens aminoglycoside 3-n-acetyltransferase

SCOP Domain Sequences for d1bo4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens}
giirtcrlgpdqvksmraaldlfgrefgdvatysqhqpdsdylgnllrsktfialaafdq
eavvgalaayvlpkfeqprseiyiydlavsgehrrqgiatalinllkheanalgayviyv
qadygddpavalytklg

SCOP Domain Coordinates for d1bo4a_:

Click to download the PDB-style file with coordinates for d1bo4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bo4a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1bo4b_