Lineage for d1b87a_ (1b87 A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 83053Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 83054Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 83055Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 83060Protein Aminoglycoside 6'-N-acetyltransferase [55731] (1 species)
  7. 83061Species Enterococcus faecium [TaxId:1352] [55732] (1 PDB entry)
  8. 83062Domain d1b87a_: 1b87 A: [40797]

Details for d1b87a_

PDB Entry: 1b87 (more details), 2.7 Å

PDB Description: crystal structure of an aminoglycoside 6'-n-acetyltransferase

SCOP Domain Sequences for d1b87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b87a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium}
miisefdrnnpvlkdqlsdllrltwpeeygdssaeeveemmnperiavaavdqdelvgfi
gaipqygitgwelhplvvessrrknqigtrlvnylekevasrggitiylgtddldhgttl
sqtdlyehtfdkvasiqnlrehpyefyeklgykivgvlpnangwdkpdiwmaktiiprpd
s

SCOP Domain Coordinates for d1b87a_:

Click to download the PDB-style file with coordinates for d1b87a_.
(The format of our PDB-style files is described here.)

Timeline for d1b87a_: