Lineage for d1c44a_ (1c44 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664171Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 1664172Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 1664173Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 1664180Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 1664183Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55722] (1 PDB entry)
  8. 1664184Domain d1c44a_: 1c44 A: [40795]

Details for d1c44a_

PDB Entry: 1c44 (more details), 1.8 Å

PDB Description: sterol carrier protein 2 (scp2) from rabbit
PDB Compounds: (A:) protein (sterol carrier protein 2)

SCOPe Domain Sequences for d1c44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ssagdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
vlpnsdkkadctitmadsdllalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgk
akl

SCOPe Domain Coordinates for d1c44a_:

Click to download the PDB-style file with coordinates for d1c44a_.
(The format of our PDB-style files is described here.)

Timeline for d1c44a_: