Lineage for d1c44a_ (1c44 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609048Fold d.106: Sterol carrier protein, SCP [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 609049Superfamily d.106.1: Sterol carrier protein, SCP [55718] (1 family) (S)
  5. 609050Family d.106.1.1: Sterol carrier protein, SCP [55719] (3 proteins)
    Pfam 02036
  6. 609057Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 609060Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [55722] (1 PDB entry)
  8. 609061Domain d1c44a_: 1c44 A: [40795]

Details for d1c44a_

PDB Entry: 1c44 (more details), 1.8 Å

PDB Description: sterol carrier protein 2 (scp2) from rabbit

SCOP Domain Sequences for d1c44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus)}
ssagdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
vlpnsdkkadctitmadsdllalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgk
akl

SCOP Domain Coordinates for d1c44a_:

Click to download the PDB-style file with coordinates for d1c44a_.
(The format of our PDB-style files is described here.)

Timeline for d1c44a_: