Lineage for d1qnda_ (1qnd A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35075Fold d.106: Sterol carrier protein 2 (SCP2) [55717] (1 superfamily)
  4. 35076Superfamily d.106.1: Sterol carrier protein 2 (SCP2) [55718] (1 family) (S)
  5. 35077Family d.106.1.1: Sterol carrier protein 2 (SCP2) [55719] (1 protein)
  6. 35078Protein Sterol carrier protein 2 (SCP2) [55720] (2 species)
  7. 35079Species Human (Homo sapiens) [TaxId:9606] [55721] (1 PDB entry)
  8. 35080Domain d1qnda_: 1qnd A: [40794]

Details for d1qnda_

PDB Entry: 1qnd (more details)

PDB Description: sterol carrier protein-2, nmr, 20 structures

SCOP Domain Sequences for d1qnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnda_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Human (Homo sapiens)}
ssasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
vlpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgn
akl

SCOP Domain Coordinates for d1qnda_:

Click to download the PDB-style file with coordinates for d1qnda_.
(The format of our PDB-style files is described here.)

Timeline for d1qnda_: