Lineage for d1qnda_ (1qnd A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533088Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2533089Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2533090Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins)
    Pfam PF02036
  6. 2533097Protein Sterol carrier protein 2 (SCP2) [55720] (3 species)
  7. 2533098Species Human (Homo sapiens) [TaxId:9606] [55721] (1 PDB entry)
  8. 2533099Domain d1qnda_: 1qnd A: [40794]

Details for d1qnda_

PDB Entry: 1qnd (more details)

PDB Description: sterol carrier protein-2, nmr, 20 structures
PDB Compounds: (A:) nonspecific lipid-transfer protein

SCOPe Domain Sequences for d1qnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnda_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Human (Homo sapiens) [TaxId: 9606]}
ssasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgs
vlpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgn
akl

SCOPe Domain Coordinates for d1qnda_:

Click to download the PDB-style file with coordinates for d1qnda_.
(The format of our PDB-style files is described here.)

Timeline for d1qnda_: