SCOP 1.71: Domain d1e42b2: 1e42 B:825-937

Lineage for d1e42b2 (1e42 B:825-937)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
   beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet

4. Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families)

5. Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)

6. Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55716] (1 PDB entry)

8. Domain d1e42b2: 1e42 B:825-937 [40793]
   Other proteins in same PDB: d1e42a1, d1e42b1
   complexed with cl, dtt, gol, mo5, nik

Details for d1e42b2

PDB Entry: 1e42, 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2

SCOP Domain Sequences for d1e42b2:

Sequence; same for both SEQRES and ATOM records:

>d1e42b2 d.105.1.1 (B:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens)}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

Timeline for d1e42b2:

• d1e42b2 first appeared (with stable ids) in SCOP 1.55
  
• d1e42b2 appears in SCOP 1.69
  
• d1e42b2 appears in SCOP 1.73
  
• d1e42b2 appears in the current release, SCOPe 2.08