Lineage for d1e42b2 (1e42 B:825-937)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35063Fold d.105: Clathrin adaptor appendage domain [55710] (1 superfamily)
  4. 35064Superfamily d.105.1: Clathrin adaptor appendage domain [55711] (1 family) (S)
  5. 35065Family d.105.1.1: Clathrin adaptor appendage domain [55712] (2 proteins)
  6. 35071Protein Beta2-adaptin AP2, C-terminal subdomain [55715] (1 species)
  7. 35072Species Human (Homo sapiens) [TaxId:9606] [55716] (1 PDB entry)
  8. 35074Domain d1e42b2: 1e42 B:825-937 [40793]
    Other proteins in same PDB: d1e42a1, d1e42b1

Details for d1e42b2

PDB Entry: 1e42 (more details), 1.7 Å

PDB Description: beta2-adaptin appendage domain, from clathrin adaptor ap2

SCOP Domain Sequences for d1e42b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e42b2 d.105.1.1 (B:825-937) Beta2-adaptin AP2, C-terminal subdomain {Human (Homo sapiens)}
lfvedgkmerqvflatwkdipnenelqfqikechlnadtvssklqnnnvytiakrnvegq
dmlyqslkltngiwilaelriqpgnpnytlslkcrapevsqyiyqvydsilkn

SCOP Domain Coordinates for d1e42b2:

Click to download the PDB-style file with coordinates for d1e42b2.
(The format of our PDB-style files is described here.)

Timeline for d1e42b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e42b1