Lineage for d1rv2c3 (1rv2 C:1-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886496Protein Exonuclease domain of family B DNA polymerases [53125] (8 species)
    elaborated with additional structures and the N-terminal subdomain
  7. 2886497Species Bacteriophage RB69 [TaxId:12353] [53127] (93 PDB entries)
    additional N-terminal subdomain contains rudimental OB-fold and rudimental ferredoxin-like fold
  8. 2886584Domain d1rv2c3: 1rv2 C:1-375 [407915]
    Other proteins in same PDB: d1rv2a4, d1rv2b4, d1rv2c4, d1rv2d4
    automated match to d1ig9a1
    protein/DNA complex

Details for d1rv2c3

PDB Entry: 1rv2 (more details), 2.8 Å

PDB Description: Crystal structure of RB69 gp43 in complex with DNA containing an abasic site analog
PDB Compounds: (C:) DNA polymerase

SCOPe Domain Sequences for d1rv2c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rv2c3 c.55.3.5 (C:1-375) Exonuclease domain of family B DNA polymerases {Bacteriophage RB69 [TaxId: 12353]}
mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
piktwdaiifnslke

SCOPe Domain Coordinates for d1rv2c3:

Click to download the PDB-style file with coordinates for d1rv2c3.
(The format of our PDB-style files is described here.)

Timeline for d1rv2c3:

  • d1rv2c3 is new in SCOPe 2.08-stable