SCOPe 2.08: Domain d1r0tb_: 1r0t B:

Lineage for d1r0tb_ (1r0t B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)

8. Domain d1r0tb_: 1r0t B: [407904]
   Other proteins in same PDB: d1r0ta_
   automated match to d1z7kb_

Details for d1r0tb_

PDB Entry: 1r0t, 1.9 Å

PDB Description: Crystal structure of trypsin-second domain of the ovomucoid turkey egg white inhibitor complex

PDB Compounds: (B:) Ovomucoid

SCOPe Domain Sequences for d1r0tb_:

Sequence; same for both SEQRES and ATOM records:

>d1r0tb_ g.68.1.1 (B:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vpmdcsrypnttseegkvmilcnkalnpvcgtdgvtydnecvlcahnleqgtsvgkkhdg
ec

Timeline for d1r0tb_:

• d1r0tb_ is new in SCOPe 2.08-stable