Lineage for d1qtpa2 (1qtp A:825-938)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 35063Fold d.105: Clathrin adaptor appendage domain [55710] (1 superfamily)
  4. 35064Superfamily d.105.1: Clathrin adaptor appendage domain [55711] (1 family) (S)
  5. 35065Family d.105.1.1: Clathrin adaptor appendage domain [55712] (2 proteins)
  6. 35066Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 35067Species Mouse (Mus musculus) [TaxId:10090] [55714] (3 PDB entries)
  8. 35069Domain d1qtpa2: 1qtp A:825-938 [40790]
    Other proteins in same PDB: d1qtpa1

Details for d1qtpa2

PDB Entry: 1qtp (more details), 1.6 Å

PDB Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage

SCOP Domain Sequences for d1qtpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtpa2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus)}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOP Domain Coordinates for d1qtpa2:

Click to download the PDB-style file with coordinates for d1qtpa2.
(The format of our PDB-style files is described here.)

Timeline for d1qtpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtpa1