Lineage for d1qtpa2 (1qtp A:825-938)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533059Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2533060Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2533061Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2533062Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 2533063Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2533066Domain d1qtpa2: 1qtp A:825-938 [40790]
    Other proteins in same PDB: d1qtpa1

Details for d1qtpa2

PDB Entry: 1qtp (more details), 1.6 Å

PDB Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage
PDB Compounds: (A:) ap-2 clathrin adaptor alpha subunit (alpha-adaptin c)

SCOPe Domain Sequences for d1qtpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qtpa2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOPe Domain Coordinates for d1qtpa2:

Click to download the PDB-style file with coordinates for d1qtpa2.
(The format of our PDB-style files is described here.)

Timeline for d1qtpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qtpa1