Lineage for d1qtsa2 (1qts A:825-938)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheetSuperfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) 
Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
Uniprot P17427 694-938 # 98% sequence identity
Domain d1qtsa2: 1qts A:825-938 [40789]
Other proteins in same PDB: d1qtsa1
Details for d1qtsa2
PDB Entry: 1qts (more details), 1.4 Å
PDB Description: crystal structure of the ap-2 clathrin adaptor alpha-appendage
PDB Compounds: (A:) ap-2 clathrin adaptor alpha subunit (alpha-adaptin c)SCOPe Domain Sequences for d1qtsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtsa2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf
SCOPe Domain Coordinates for d1qtsa2:
Click to download the PDB-style file with coordinates for d1qtsa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qtsa2:
- d1qtsa2 first appeared (with stable ids) in SCOP 1.55
- d1qtsa2 appears in SCOPe 2.07
View in 3D
