Lineage for d1biba3 (1bib A:64-270)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1036802Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1036803Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) (S)
  5. 1037018Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)
  6. 1037019Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
    this structure contains an SH2-like fold
  7. 1037020Species Escherichia coli [TaxId:562] [55709] (4 PDB entries)
  8. 1037024Domain d1biba3: 1bib A:64-270 [40788]
    Other proteins in same PDB: d1biba1, d1biba2
    complexed with btn

Details for d1biba3

PDB Entry: 1bib (more details), 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains
PDB Compounds: (A:) bir a

SCOPe Domain Sequences for d1biba3:

Sequence, based on SEQRES records: (download)

>d1biba3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records): (download)

>d1biba3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspfga
nlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilve
ltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrw
ekldn

SCOPe Domain Coordinates for d1biba3:

Click to download the PDB-style file with coordinates for d1biba3.
(The format of our PDB-style files is described here.)

Timeline for d1biba3: