SCOP 1.75: Domain d1biba3: 1bib A:64-270

Lineage for d1biba3 (1bib A:64-270)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)
   this structure contains an SH2-like fold

7. Species Escherichia coli [TaxId:562] [55709] (4 PDB entries)

8. Domain d1biba3: 1bib A:64-270 [40788]
   Other proteins in same PDB: d1biba1, d1biba2
   complexed with btn

Details for d1biba3

PDB Entry: 1bib, 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

PDB Compounds: (A:) bir a

SCOP Domain Sequences for d1biba3:

Sequence, based on SEQRES records:

>d1biba3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records):

>d1biba3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspfga
nlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilve
ltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrw
ekldn

Timeline for d1biba3:

• d1biba3 first appeared (with stable ids) in SCOP 1.55, called d1bib_3
  
• d1biba3 appears in SCOP 1.73
  
• d1biba3 appears in SCOPe 2.01
  
• d1biba3 appears in the current release, SCOPe 2.08