SCOP 1.57: Domain d1bib_3: 1bib 64-270

Lineage for d1bib_3 (1bib 64-270)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein)

6. Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species)

7. Species Escherichia coli [TaxId:562] [55709] (3 PDB entries)

8. Domain d1bib_3: 1bib 64-270 [40788]
   Other proteins in same PDB: d1bib_1, d1bib_2

Details for d1bib_3

PDB Entry: 1bib, 2.8 Å

PDB Description: the e. coli biotin holoenzyme synthetase(slash)bio repressor crystal structure delineates the biotin and dna-binding domains

SCOP Domain Sequences for d1bib_3:

Sequence, based on SEQRES records:

>d1bib_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw
fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk
lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli
relraalelfeqeglapylsrwekldn

Sequence, based on observed residues (ATOM records):

>d1bib_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli}
iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspfga
nlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilve
ltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrw
ekldn

Timeline for d1bib_3:

• d1bib_3 first appeared (with stable ids) in SCOP 1.55
  
• d1bib_3 appears in SCOP 1.59
  
• d1bib_3 appears in the current release, SCOPe 2.08, called d1biba3