Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (2 families) |
Family d.104.1.2: Biotin holoenzyme synthetase [55707] (1 protein) |
Protein Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain [55708] (1 species) |
Species Escherichia coli [TaxId:562] [55709] (2 PDB entries) |
Domain d1bib_3: 1bib 64-270 [40788] Other proteins in same PDB: d1bib_1, d1bib_2 |
PDB Entry: 1bib (more details), 2.8 Å
SCOP Domain Sequences for d1bib_3:
Sequence, based on SEQRES records: (download)
>d1bib_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrrgrkw fspfganlylsmfwrleqgpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrk lagilveltgktgdaaqivigaginmamrrveesvvnqgwitlqeaginldrntlaamli relraalelfeqeglapylsrwekldn
>d1bib_3 d.104.1.2 (64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli} iqllnakqilgqldggsvavlpvidstnqylldrigelksgdaciaeyqqagrgrspfga nlylsmfwrleqpaaaiglslvigivmaevlrklgadkvrvkwpndlylqdrklagilve ltgaaqivigaginmamwitlqeaginldrntlaamlirelraalelfeqeglapylsrw ekldn
Timeline for d1bib_3: